PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI11G03860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 472aa    MW: 52298.5 Da    PI: 4.5341
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI11G03860.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS183.91.1e-56483912354
             GRAS   2 velLlecAeavssgdlelaqalLarlsel.....aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                       +lLl+ Aeav++gd  la+ + +rl +       + +++++ Rla +f ++L++r+++ ++++y+   p++ +    s ++ ++++ +e+sP+
  ORUFI11G03860.1  48 SDLLLAGAEAVEAGDSILASVAFSRLDDFlsgipENGAASSFDRLAYHFDQGLRSRMSSASTGCYQ---PEPLP----SGNMLVHQIIQELSPF 134
                      679***********************998554333334479******************9899984...55554....456778899******* PP

             GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak 184
                      +kf+h+t+NqaIl+a+ g+  vH++D++i++G+QW +L+  La    g  s+R+T++   +  ++ +  ++ + L++fA++l++pf++n + ++
  ORUFI11G03860.1 135 VKFAHFTTNQAILDAIIGDMDVHVVDLNIGEGIQWSSLMSDLAR--CGGKSFRLTAITTYADCHASTHDTVVRLLSEFADSLELPFQYNSICVH 226
                      *******************************************7..4668*********887799999999999****************8777 PP

             GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe.......adhnsesFlerflealeyysalfdsl 271
                      + ++l  +++  + + +++V++    ++    s+s+ +  + +L +vk+l+Pk+vv +e++       ++ +s+sF+e f+eal++++++fds+
  ORUFI11G03860.1 227 NEDEL--HAFFEDCKGSVIVSCDTTSMYYK--SLSTLQ--SLLLVCVKKLQPKLVVTIEEDlvrigrgVSPSSASFVEFFFEALHHFTTVFDSM 314
                      65555..777777799******99777775..554444..69*******************6555443444666******************** PP

             GRAS 272 eaklpres..eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                      ++ +   s     + vE ellg++i++ v + g+ r+e +      +e l   GF + +ls  + +qa++l+  ++ + + v  +
  ORUFI11G03860.1 315 ASCFIGSSyePCLRLVEMELLGPRIQDFVVKYGSVRVEANA-----SEVL--EGFMACELSACNIAQARMLVGLFN-RVFGVVFK 391
                      77776666578899*********************999888.....5555..5********************999.44555544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098530.45521392IPR005202Transcription factor GRAS
PfamPF035143.9E-5448391IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MVLDSNELHQ HDAPDVDVSI NCDDRIFGQE SVNLAAIQEE LLEEDSLSDL LLAGAEAVEA  60
GDSILASVAF SRLDDFLSGI PENGAASSFD RLAYHFDQGL RSRMSSASTG CYQPEPLPSG  120
NMLVHQIIQE LSPFVKFAHF TTNQAILDAI IGDMDVHVVD LNIGEGIQWS SLMSDLARCG  180
GKSFRLTAIT TYADCHASTH DTVVRLLSEF ADSLELPFQY NSICVHNEDE LHAFFEDCKG  240
SVIVSCDTTS MYYKSLSTLQ SLLLVCVKKL QPKLVVTIEE DLVRIGRGVS PSSASFVEFF  300
FEALHHFTTV FDSMASCFIG SSYEPCLRLV EMELLGPRIQ DFVVKYGSVR VEANASEVLE  360
GFMACELSAC NIAQARMLVG LFNRVFGVVF KKISLLMVYY ISLGKNDLRE PNKVIWSSLA  420
AGCGSHGIVV LAFYAADKLL EFKPKGIETY IHPAVERAHF HKEDRMWQEY EN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-169037941340GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1205340.0AC120534.5 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBa0084A20, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBankCP0126190.0CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617104.10.0PREDICTED: nodulation-signaling pathway 2 protein
TrEMBLA0A0E0R4J60.0A0A0E0R4J6_ORYRU; Uncharacterized protein
STRINGLOC_Os11g06180.10.0(Oryza sativa Japonica Group)
STRINGORGLA11G0036600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP76843250
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08250.11e-29GRAS family protein